To report bugs, please contact
Cai X.-J. Zhang at chk@uoxray.uoregon.eduAlso see: MATCH3D
1D_A file_name [format]
1D_A card is used to input the structural information for the sequence A.
The file file_name.seq is read for the sequence information. Another file
file_name.gap, if exists, is read for the relative gap-penalty information (otherwise
the file file_name.seq is used for the same purpose. The Fortran format
is used for reading both files. The default format is (100A1). Any space within the
input sequence will be deleted before comparison.
1D_B file_name
CONTROL nr [,random_seed, overall_penalty, first_threshold, second_threshold, end#, file_name]1D_Bis used to input the structural information for the sequence B. (See also 1D_A).1D_Balso starts the comparison between the currently input sequence and the sequence previously input with1D_A.
nr (an integer number) is the number of random comparison. The default is 0.INCLUDE parameter_file_namerandom_seed (integer) is a seed for choosing a random number. The default is 1.
overall_penalty (a real number number) is the overall gal-penalty. The real gap-penalty used at each position is the overall gap-penalty times the relative gap-penalty input in the
1D_Aor1D_Bcard.first_threshold (a real number number) is the value above which the pair will be marked with a colmne, ':'. The default is 0.5.
second_threshold (a real number number) is the value above which the pair will be marked with a virtical line, '|'. The default is 1.0.
end# (an integer number) may be used to force the ends of the two sequences to match with each other within a few residues (ie. end#). The default value is equivalent to no restriction.
file_name defines a file to output a list of the best match. The default is no-output.
PENALTY_TABLE file_nameINCLUDEdefines an input parameter file, which may contain any input cards, including theINCLUDEcard itself.
QUITPENALTY_TABLEinputs a relative gap-penalty table. The characters defined in the gap-penalty table should include all the characters in the input gap-penalty file (see1D_A). The default gap-penalty table is an even distribution for all the amino acid residues. It is stored in a file called penalty_table.dat. For the format of the table, see the default file.
QUIT stops the program. It functions the same as [end_of_file] (eg. control-Z while running the program interactively).SCORE_TABLE file_name
!commentSCORE_TABLEinputs the table a score matrix. The characters defined in the score table should include all the characters in the input sequence file (see1D_A). The default score matrix is the Dayhoff matrix stored in a file called score_table.dat. For the format of the score matrix, see the default file.
Any input line starting with a semicolon (;) or an exclamation mark (!) will be ignored.
$ run match1d control 30 1 0.1 0.5 1.0 1000 1d_a p22l 1d_b t4l quit $The output is the following.
< control 30 1 0.1 0.5 1.0 1000
NR= 30, ISEED= 1 PE= 0.10, end#= 1000
< 1d_a p22l
< 1d_b t4l
Length 1 = 146, length 2 = 162
Score= 67.400, Ratio= 0.462
# of gaps = 5, 1
IDENTICAL MATCHES= 42
, , , , , ,
1 mmqissngitrlkreegerlkaysdsrgiptigvgh--tgkvdgnsvasgm---------
| . |. .|| ||| | | | |||:|| | | | :
1 -----mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncn
, , , , , ,
50 -titaekssellkedlqwvedaisslvrvplnqnqyd--------alcslifnigksafa
|| . |: .| |. |: ...| || || ::| .| . |
56 gvitkdeaeklfnqd---vdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgva
, , , , , ,
101 gst-vlrqlnlknyqaaadafllwkkagkdpd----illprrrreralfls
| | || | | :. || : . |. :. | : :
113 gftnslrmlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk-
Score= 44.500, Ratio= 0.305
... (omitted 28 lines)
Score= 51.200, Ratio= 0.351
# of RANDOM TRY= 30
AV_RATIO = 0.306
SIGMA = 0.021
SIGNIFICANCE = 7.324 sgm
< quit
where score is the maximum score according to the input
score matrix; ratio is the score divided by
the smaller residues number of the two sequences being compared.
Henikoff S., Henikoff J.G. (1993). Performance evaluation of amino acid substitution matrices. Proteins 17:49-61.
Pearson W.R., Lipman D.J. (1988). Improved tools for biological sequence comparison. Proc. Natl. Acad. Sci. U.S.A. 85:2444-2448.
Smith T.F., Waterman M.S. (1981). Comparison of bio-sequences. Adv. Appl. Math. 2:482-489